PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 28650.m000189
Common NameLOC8287882, RCOM_0300620
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family GRAS
Protein Properties Length: 662aa    MW: 75340.7 Da    PI: 6.569
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
28650.m000189genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS375.95.2e-1152896582374
           GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshlt 97 
                     +lL++cA+a  +gd++ a + L+ ++ +asp+gd++qRla+yf++AL+arla+s++ +  +l   +++  n+++ l+a++l++ v+P+ k+s++ 
  28650.m000189 289 STLLIQCAQATGTGDQRTAYQQLKLIRLHASPYGDANQRLAHYFANALEARLAGSGKLMP-TLFIGPST--NTADILKAYQLYVSVCPFRKMSNFF 381
                    579***************************************************655554.55444444..589********************** PP

           GRAS  98 aNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledlel 191
                    +N++I +ave+++r+HiiDf+is+G+QWp+++  L++Rp+gpp++RiTg++ p++g    e++eetg+rL+++A++l+vpfe+n+ +a+++e+++ 
  28650.m000189 382 TNRTITKAVEKATRLHIIDFGISYGFQWPCFIYHLSTRPGGPPKVRITGIDYPQPGfrPGERVEETGRRLKRLADKLNVPFEYNA-IAQKWETIQG 476
                    *******************************************************9*9***************************.7********* PP

           GRAS 192 eeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvEr 287
                    e+L+++++E++aV+++ +l++l+d++  l+s+rd+vL+l+ks++P ++ +   + ++n++ F++rf eal ++s+lfd++ea + re++er + Er
  28650.m000189 477 EDLQIDKDEVVAVCCMNRLKNLPDDTIVLDSPRDAVLRLIKSINPVIFLHGVVNGSYNAPFFATRFREALFHFSSLFDMFEAIATREDQERLVFER 572
                    ************************************************************************************************ PP

           GRAS 288 ellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                    el+g++++nvvaceg+er+er et+++W+ r ++ GF+++pl ++++k ++ + + +++d + v+e+ +++++gWk+r + ++SaW+
  28650.m000189 573 ELIGKDVMNVVACEGSERFERPETYKQWQIRNSRIGFRQLPLHQDIVKRVRNIKNDYHKD-FAVDEDGHWMLMGWKGRIIHAISAWK 658
                    **********************************************************77.*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098564.155262639IPR005202Transcription factor GRAS
PfamPF035141.8E-112289658IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 662 aa     Download sequence    Send to blast
MGGKFEFRSF QVSSNHINPD DGFGFNLESV NSASLTTNLQ PFRSSTRSFE LSSYGDSAYN  60
SETSNFSQAV LKYISDMLME EDLEDKPCML QDCLALQAAE KSLYDVLGEK YPPICDQSPS  120
SIDQNNENPD DYFATASDVG SCNSYPSADN LAELNWNFDQ GKFESANILN RVTGNVNKLP  180
DSAPQKSGRS FLSNLSRGRK NQQHENGSYL EEEGRSKKHS AVIYTGVSDQ LEIFDNSFLH  240
KVENNESLPC PLFDASRNEE SKKLQQNEQS PNNTRMRRHA KDKKMFDLST LLIQCAQATG  300
TGDQRTAYQQ LKLIRLHASP YGDANQRLAH YFANALEARL AGSGKLMPTL FIGPSTNTAD  360
ILKAYQLYVS VCPFRKMSNF FTNRTITKAV EKATRLHIID FGISYGFQWP CFIYHLSTRP  420
GGPPKVRITG IDYPQPGFRP GERVEETGRR LKRLADKLNV PFEYNAIAQK WETIQGEDLQ  480
IDKDEVVAVC CMNRLKNLPD DTIVLDSPRD AVLRLIKSIN PVIFLHGVVN GSYNAPFFAT  540
RFREALFHFS SLFDMFEAIA TREDQERLVF ERELIGKDVM NVVACEGSER FERPETYKQW  600
QIRNSRIGFR QLPLHQDIVK RVRNIKNDYH KDFAVDEDGH WMLMGWKGRI IHAISAWKPI  660
EE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-512926588375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002533751.10.0PREDICTED: scarecrow-like protein 14
TrEMBLB9T6820.0B9T682_RICCO; Chitin-inducible gibberellin-responsive protein, putative
STRINGPOPTR_0009s03830.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13134339
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G29060.11e-176GRAS family protein